TCEAL1 Antibody

Western Blot: TCEAL1 Antibody [H00009338-B01P] - Analysis of TCEAL1 expression in transfected 293T cell line by TCEAL1 polyclonal antibody. Lane 1: TCEAL1 transfected lysate(17.49 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: TCEAL1 Antibody [H00009338-B01P] - Analysis of purified antibody to TCEAL1 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

TCEAL1 Antibody Summary

• Immunogen: TCEAL1 (NP_001006640.1, 1 a.a. - 159 a.a.) full-length human protein. MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
• Specificity: TCEAL1 - transcription elongation factor A (SII)-like 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TCEAL1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCEAL1 Antibody

• Nuclear phosphoprotein p21/SIIR
• p21
• pp21
• SIIRTCEA-like protein 1
• transcription elongation factor A (SII)-like 1
• transcription elongation factor A protein-like 1
• Transcription elongation factor S-II protein-like 1

Background

This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCEAL1
• Entrez:
  • 9338(Human)
• Uniprot:
  • NP_001006640.1(Human)