TBC1D7 Antibody - BSA Free

Immunohistochemistry-Paraffin: TBC1D7 Antibody [NBP1-84231] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TBC1D7 Antibody [NBP1-84231] - Staining of human testis shows weak to moderate granular cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: TBC1D7 Antibody [NBP1-84231] - Staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: TBC1D7 Antibody [NBP1-84231] - Staining of human cerebral cortex shows moderate to strong granular positivity in neuropil.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBC1D7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBC1D7 Antibody - BSA Free (NBP1-84231) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TRRFVNQLNTKYRDSLPQLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBC1D7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TBC1D7 Protein (NBP1-84231PEP)

Reactivity Notes

Rat (81%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TBC1D7 Antibody - BSA Free

• cell migration-inducing protein 23
• dJ257A7.3
• DKFZp686N2317
• FLJ32666
• PIG51
• TBC1 domain family member 7
• TBC1 domain family, member 7
• TBC7
• TCD1D7

Background

TBC1D7 belongs to the family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6; MIM 604334), yeast Bub2, and CDC16 (MIM 603461) (Nakashima et al., 2007 (PubMed 17658474)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBC1D7