Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Concentration | 0.5 mg/ml |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAS1R2. Peptide sequence: ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTE The peptide sequence for this immunogen was taken from within the described region. |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TAS1R2 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 93 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TAS1R2 Antibody (NBP2-82355)Find related products by research area.
|
Taste Infographic: Explaining Taste from the Tongue to the Brain The sense of taste involves the reaction of chemicals with nerve cells which send messages to the brain to create the perception of flavor. Learn more about taste and in the infographic below.Novus Biologicals offers research reagents mentioned in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TAS1R2 |