TAO Kinase 1 Recombinant Protein Antigen

Images

 
There are currently no images for TAO Kinase 1 Protein (NBP1-89864PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TAO Kinase 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAOK1.

Source: E. coli

Amino Acid Sequence: LSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAOK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89864.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TAO Kinase 1 Recombinant Protein Antigen

  • EC 2.7.11
  • FLJ14314
  • hKFC-B
  • hTAOK1
  • KIAA1361
  • KIAA1361STE20-like kinase PSK2
  • Kinase from chicken homolog B
  • MAP3K16
  • MAP3K16EC 2.7.11.1
  • MARK Kinase
  • MARKK
  • MARKKmicrotubule affinity regulating kinase kinase
  • PSK2
  • PSK-2
  • PSK2serine/threonine kinase TAO1
  • serine/threonine-protein kinase TAO1
  • TAO Kinase 1
  • TAO1serine/threonine protein kinase TAO1 homolog
  • TAOK1
  • Thousand and one amino acid protein 1

Background

TAOK1, a member of the Ste20 kinase family, is a TAO type protein kinase that acts as an upstream activator to MARK by phosphorylation. When activated, MARK enhances microtubule dynamics and leads to phosphorylation and detachment of tau or equivalent MAPs from microtubules. Overexpression of MARK eventually leads to microtubule breakdown and cell death, but in neuronal cells the primary effect is to allow the development of neurites during differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52508
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC,  IHC-P, WB
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-45954
Species: Hu, Mu
Applications: ELISA, IHC, WB
H00002011-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-72710
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5928
Species: Hu
Applications: ICC, IHC, WB
NBP2-30662
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-79842
Species: Hu, Mu
Applications: IP, WB
AF4185
Species: Hu
Applications: ICC
AF4916
Species: Hu, Mu
Applications: IHC, WB

Publications for TAO Kinase 1 Protein (NBP1-89864PEP) (0)

There are no publications for TAO Kinase 1 Protein (NBP1-89864PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAO Kinase 1 Protein (NBP1-89864PEP) (0)

There are no reviews for TAO Kinase 1 Protein (NBP1-89864PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TAO Kinase 1 Protein (NBP1-89864PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAO Kinase 1 Products

Research Areas for TAO Kinase 1 Protein (NBP1-89864PEP)

Find related products by research area.

Blogs on TAO Kinase 1

There are no specific blogs for TAO Kinase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TAO Kinase 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TAOK1