![Western Blot: TAK1L Antibody [H00056911-B01P] - Analysis of C21orf7 expression in transfected 293T cell line by C21orf7 polyclonal antibody. Lane 1: C21orf7 transfected lysate(26.62 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TAK1L-Antibody-Western-Blot-H00056911-B01P-img0004.jpg "Western Blot: TAK1L Antibody [H00056911-B01P] - Analysis of C21orf7 expression in transfected 293T cell line by C21orf7 polyclonal antibody. Lane 1: C21orf7 transfected lysate(26.62 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse TAK1L Antibody - Azide and BSA Free (H00056911-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | C21orf7 (NP_064537.1, 1 a.a. - 242 a.a.) full-length human protein. MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRYFAQVGLEHLASSSPPAFGFLKCLDYSISVLCSATSLAMLEDNPKVSKLATGDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS |
| Specificity | C21orf7 - chromosome 21 open reading frame 7, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | C21ORF7 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Flow Cytometry Chondrolectin Antibody (396305) [Unconjugated]](https://images.novusbio.com/images2/Chondrolectin_MAB2576_Flow_Cytometry_8382.jpg)
![Immunocytochemistry Chondrolectin Antibody (396305) [Unconjugated]](https://images.novusbio.com/images2/Chondrolectin_MAB2576_Immunocytochemistry__Immunofluorescence_19905.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C21ORF7 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: TAK1L Antibody [H00056911-B01P] - Analysis of purified antibody to C21orf7 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/TAK1L-Antibody-Immunocytochemistry-Immunofluorescence-H00056911-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: TAK1L Antibody [H00056911-B01P] - Analysis of purified antibody to C21orf7 on HeLa cell. (antibody concentration 10 ug/ml)")
![TACE/ADAM17 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "TACE/ADAM17 [Unconjugated]")
![Western Blot Cyclin D1/D2 Antibody [Unconjugated] - Cross-reactive](https://images.novusbio.com/images2/Cyclin_D2_AF4196_Western_Blot_5420.jpg)
![Intracellular Staining by Flow Cytometry Cyclin D1/D2 Antibody [Unconjugated] - Cross-reactive](https://images.novusbio.com/images2/Cyclin_D2_AF4196_Flow_Cytometry_11836.jpg)
![Western Blot Cyclin D1/D2 Antibody [Unconjugated] - Cross-reactive](https://images.novusbio.com/images/af4196_human-mouse-cyclin-d1-d2-affinity-purified-polyclonal-ab-western-blot-12122025857410.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")