TAF9b Antibody - BSA Free

Western Blot: TAF9b Antibody [NBP2-88404] - Host: Rabbit. Target Name: TAF9B. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TAF9b Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TAF9b Antibody - BSA Free (NBP2-88404) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAF9b. Peptide sequence: TAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF9B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TAF9b Antibody - BSA Free

• 31kDa
• DN7
• DN-7Transcription-associated factor TAFII31L
• Neuronal cell death-related protein 7
• TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TAF9-like RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TAF9Ltranscription associated factor TAFII31L
• TAFII31LTBP-associated factor 9L
• TFIID-31
• transcription initiation factor IID, 31kD subunit
• transcription initiation factor TFIID subunit 9B
• Transcription initiation factor TFIID subunit 9-like

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein thatcoordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position thepolymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as achannel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarilyconserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve ascoactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complexassembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits ofTFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also havedistinct roles in the transcriptional regulatory process. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF9B