TAF9b Antibody - Azide and BSA Free

Western Blot: TAF9b Antibody [H00051616-B01P] - Analysis of TAF9B expression in transfected 293T cell line by TAF9B polyclonal antibody. Lane 1: TAF9B transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TAF9b Antibody - Azide and BSA Free Summary

• Immunogen: TAF9B (NP_057059.2, 1 a.a. - 251 a.a.) full-length human protein. MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TAF9B
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAF9b Antibody - Azide and BSA Free

• 31kDa
• DN7
• DN-7Transcription-associated factor TAFII31L
• Neuronal cell death-related protein 7
• TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TAF9-like RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TAF9Ltranscription associated factor TAFII31L
• TAFII31LTBP-associated factor 9L
• TFIID-31
• transcription initiation factor IID, 31kD subunit
• transcription initiation factor TFIID subunit 9B
• Transcription initiation factor TFIID subunit 9-like

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein thatcoordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position thepolymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as achannel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarilyconserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve ascoactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complexassembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits ofTFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also havedistinct roles in the transcriptional regulatory process. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF9B
• Uniprot:
  • NP_057059.2(Human)