TAF7L Antibody - BSA Free

Western Blot: TAF7L Antibody [NBP1-80292] - SP2/0 cell lysate, concentration 1.25ug/ml.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

TAF7L Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of mouse TAF7L. Peptide sequence EGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF7L
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for TAF7L Antibody - BSA Free

• 50kDa
• CT40FLJ23157
• RNA polymerase II TBP-associated factor subunit Q
• TAF2QRNA polymerase II, Q
• TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TATA box binding protein (TBP)-associated factor, RNA polymerase II, Q
• TATA box-binding protein-associated factor 50 kDa
• transcription initiation factor TFIID subunit 7-like

Background

TAF7L is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF7L
• Uniprot:
  • NP_083234(Mouse)