Recombinant Human TAF7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TAF7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-349 of Human TAF7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TAF7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAF7 Protein

  • TAF(II)55
  • TAF2FTBP-associated factor F
  • TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
  • TAFII-55
  • TAFII55RNA polymerase II TBP-associated factor subunit F
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD
  • transcription factor IID subunit TAFII55
  • Transcription initiation factor TFIID 55 kDa subunit
  • transcription initiation factor TFIID subunit 7
  • transcription initiation factor TFIID, 55 kDa subunit

Background

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-84350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBL1-11392
Species: Hu
AF6349
Species: Hu, Mu, Rt
Applications: WB
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55408
Species: Hu
Applications: WB, ICC/IF
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006879-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TAF7 Recombinant Protein (H00006879-P01) (0)

There are no publications for TAF7 Recombinant Protein (H00006879-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF7 Recombinant Protein (H00006879-P01) (0)

There are no reviews for TAF7 Recombinant Protein (H00006879-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF7 Recombinant Protein (H00006879-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF7 Products

Bioinformatics Tool for TAF7 Recombinant Protein (H00006879-P01)

Discover related pathways, diseases and genes to TAF7 Recombinant Protein (H00006879-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF7 Recombinant Protein (H00006879-P01)

Discover more about diseases related to TAF7 Recombinant Protein (H00006879-P01).
 

Pathways for TAF7 Recombinant Protein (H00006879-P01)

View related products by pathway.

PTMs for TAF7 Recombinant Protein (H00006879-P01)

Learn more about PTMs related to TAF7 Recombinant Protein (H00006879-P01).

Blogs on TAF7

There are no specific blogs for TAF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TAF7 Antibody (2C5)
H00006879-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAF7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF7