TAF7 Recombinant Protein Antigen

Images

 
There are currently no images for TAF7 Protein (NBP1-80704PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TAF7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAF7.

Source: E. coli

Amino Acid Sequence: ISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAF7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80704.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TAF7 Recombinant Protein Antigen

  • TAF(II)55
  • TAF2FTBP-associated factor F
  • TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
  • TAFII-55
  • TAFII55RNA polymerase II TBP-associated factor subunit F
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD
  • transcription factor IID subunit TAFII55
  • Transcription initiation factor TFIID 55 kDa subunit
  • transcription initiation factor TFIID subunit 7
  • transcription initiation factor TFIID, 55 kDa subunit

Background

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
3047-CC
Species: Hu
Applications: BA
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
DPSG10
Species: Hu
Applications: ELISA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP1-84350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00008805-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
NBP3-46159
Species: Hu, Mu, Rt
Applications: ELISA, IHC
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP3-35718
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-41380
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-80704PEP
Species: Hu
Applications: AC

Publications for TAF7 Protein (NBP1-80704PEP) (0)

There are no publications for TAF7 Protein (NBP1-80704PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF7 Protein (NBP1-80704PEP) (0)

There are no reviews for TAF7 Protein (NBP1-80704PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TAF7 Protein (NBP1-80704PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF7 Products

Blogs on TAF7

There are no specific blogs for TAF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TAF7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF7