TAF6L Antibody

Images

 
Western Blot: TAF6L Antibody [NBP1-74133] - Rat Brain Lysate 1.0 ug/ml, gel concentration 12%

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF6L Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Taf6l. Immunizing peptide sequence PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS.
Specificity
This product is specific to Subunit or Isofrom: 6L.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF6L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Taf6l and was validated on Western blot.
Theoretical MW
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TAF6L Antibody

  • FLJ11136
  • p300/CBP-associated factor (PCAF)-associated factor 65
  • PAF65-alpha
  • PAF65AMGC4288
  • PCAF-associated factor 65 alpha
  • PCAF-associated factor 65-alpha
  • TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 6L
  • TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD
  • TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00006879-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-82774
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-511
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-18878
Species: Hu
Applications: WB, IHC-P, IP
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-41266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-80638
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000900-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-92474
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-74133
Species: Rt
Applications: WB

Publications for TAF6L Antibody (NBP1-74133) (0)

There are no publications for TAF6L Antibody (NBP1-74133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF6L Antibody (NBP1-74133) (0)

There are no reviews for TAF6L Antibody (NBP1-74133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF6L Antibody (NBP1-74133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAF6L Products

Bioinformatics Tool for TAF6L Antibody (NBP1-74133)

Discover related pathways, diseases and genes to TAF6L Antibody (NBP1-74133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TAF6L Antibody (NBP1-74133)

View related products by pathway.

PTMs for TAF6L Antibody (NBP1-74133)

Learn more about PTMs related to TAF6L Antibody (NBP1-74133).

Blogs on TAF6L

There are no specific blogs for TAF6L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF6L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF6L
Uniprot