TAF6L Antibody


Western Blot: TAF6L Antibody [NBP1-74133] - Rat Brain Lysate 1.0 ug/ml, gel concentration 12%

Product Details

Reactivity RtSpecies Glossary
Applications WB

Order Details

TAF6L Antibody Summary

Synthetic peptides corresponding to the middle region of Taf6l. Immunizing peptide sequence PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS.
This product is specific to Subunit or Isoform: 6L.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Taf6l and was validated on Western blot.
Theoretical MW
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TAF6L Antibody

  • FLJ11136
  • p300/CBP-associated factor (PCAF)-associated factor 65
  • PAF65-alpha
  • PAF65AMGC4288
  • PCAF-associated factor 65 alpha
  • PCAF-associated factor 65-alpha
  • TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 6L
  • TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD
  • TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IP (-), WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB

Publications for TAF6L Antibody (NBP1-74133) (0)

There are no publications for TAF6L Antibody (NBP1-74133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF6L Antibody (NBP1-74133) (0)

There are no reviews for TAF6L Antibody (NBP1-74133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF6L Antibody (NBP1-74133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TAF6L Products

Bioinformatics Tool for TAF6L Antibody (NBP1-74133)

Discover related pathways, diseases and genes to TAF6L Antibody (NBP1-74133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TAF6L Antibody (NBP1-74133)

View related products by pathway.

PTMs for TAF6L Antibody (NBP1-74133)

Learn more about PTMs related to TAF6L Antibody (NBP1-74133).

Blogs on TAF6L

There are no specific blogs for TAF6L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TAF6L Antibody and receive a gift card or discount.


Gene Symbol TAF6L