Recombinant Human TAF1C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TAF1C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 761-869 of Human TAF1C partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF

Protein/Peptide Type
Partial Recombinant Protein
Gene
TAF1C

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAF1C Protein

  • MGC:39976
  • RNA polymerase I-specific TBP-associated factor 110 kDa
  • SL1, 110kD subunit
  • SL1TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD
  • TAFI110TBP-associated factor 1C
  • TAFI95
  • TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa
  • TATA box-binding protein-associated factor 1C
  • TATA box-binding protein-associated factor RNA polymerase I subunit C
  • transcription factor SL1
  • Transcription initiation factor SL1/TIF-IB subunit C

Background

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009014-B01P
Species: Hu
Applications: WB, ICC/IF
AF1334
Species: Hu
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71822
Species: Hu
Applications: WB, IP
NBP1-86626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
MAB6799
Species: Hu
Applications: WB, IHC
H00009013-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TAF1C Partial Recombinant Protein (H00009013-Q01) (0)

There are no publications for TAF1C Partial Recombinant Protein (H00009013-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF1C Partial Recombinant Protein (H00009013-Q01) (0)

There are no reviews for TAF1C Partial Recombinant Protein (H00009013-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF1C Partial Recombinant Protein (H00009013-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF1C Products

Bioinformatics Tool for TAF1C Partial Recombinant Protein (H00009013-Q01)

Discover related pathways, diseases and genes to TAF1C Partial Recombinant Protein (H00009013-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF1C Partial Recombinant Protein (H00009013-Q01)

Discover more about diseases related to TAF1C Partial Recombinant Protein (H00009013-Q01).
 

Pathways for TAF1C Partial Recombinant Protein (H00009013-Q01)

View related products by pathway.

PTMs for TAF1C Partial Recombinant Protein (H00009013-Q01)

Learn more about PTMs related to TAF1C Partial Recombinant Protein (H00009013-Q01).

Blogs on TAF1C

There are no specific blogs for TAF1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UBTF Antibody
NBP1-82545
TAF1C Antibody
NBP2-12779

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAF1C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF1C