TAF1C Antibody [HRP]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: HRP

TAF1C Antibody [HRP] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-320 of human TAF1C (NP_001230085.1).
  
  Sequence:
  PPLIDPWDPGLTARDLLFRGGYRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTKKKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQRRFSILGGPILGTSVASHLAELLHEELVLRWEQLLLDEACTGGALAWVPGRTPQFGQLVYPAGGAQDRLHFQEVVLTPGDNPQFLGKPGRIQLQGPVRQVVTCTVQGETLLAVRSDYHCAVWKFGKQWQPTLLQAMQVEKGATGISLSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF1C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Alternate Names for TAF1C Antibody [HRP]

• MGC:39976
• RNA polymerase I-specific TBP-associated factor 110 kDa
• SL1, 110kD subunit
• SL1TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD
• TAFI110TBP-associated factor 1C
• TAFI95
• TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa
• TATA box-binding protein-associated factor 1C
• TATA box-binding protein-associated factor RNA polymerase I subunit C
• transcription factor SL1
• Transcription initiation factor SL1/TIF-IB subunit C

Background

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-bindingprotein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, bindsto the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatorysignals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have beenidentified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF1C