TAF148 Antibody (1F8)

Images

 
Sandwich ELISA: TAF148 Antibody (1F8) [H00009015-M01] - Detection limit for recombinant GST tagged TAF1A is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAF148 Antibody (1F8) Summary

Immunogen
TAF1A (NP_005672, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIW
Specificity
TAF1A - TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAF1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAF148 Antibody (1F8)

  • RAFI48
  • SL1MGC:17061
  • TAFI48TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kD
  • TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
  • TATA box-binding protein-associated factor 1A
  • TATA box-binding protein-associated factor RNA polymerase I subunit A
  • TBP-associated factor 1A
  • Transcription factor SL1,48kD subunit

Background

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the smallest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12779
Species: Hu
Applications: WB, IP
H00009014-B01P
Species: Hu
Applications: WB, ICC/IF
AF1334
Species: Hu
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71822
Species: Hu
Applications: WB, IP
NBP1-86626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00009015-M01
Species: Hu
Applications: WB, ELISA

Publications for TAF148 Antibody (H00009015-M01) (0)

There are no publications for TAF148 Antibody (H00009015-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF148 Antibody (H00009015-M01) (0)

There are no reviews for TAF148 Antibody (H00009015-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF148 Antibody (H00009015-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAF148 Products

Bioinformatics Tool for TAF148 Antibody (H00009015-M01)

Discover related pathways, diseases and genes to TAF148 Antibody (H00009015-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF148 Antibody (H00009015-M01)

Discover more about diseases related to TAF148 Antibody (H00009015-M01).
 

Pathways for TAF148 Antibody (H00009015-M01)

View related products by pathway.

PTMs for TAF148 Antibody (H00009015-M01)

Learn more about PTMs related to TAF148 Antibody (H00009015-M01).

Blogs on TAF148

There are no specific blogs for TAF148, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF148 Antibody (1F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF1A
Entrez
OMIM
Uniprot