TAF11 Antibody (2G9)

Western Blot: TAF11 Antibody (2G9) [H00006882-M04] - Analysis of TAF11 expression in Hela S3 NE (Cat # L013V3).

Immunocytochemistry/Immunofluorescence: TAF11 Antibody (2G9) [H00006882-M04] - Analysis of monoclonal antibody to TAF11 on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: TAF11 Antibody (2G9) [H00006882-M04] - Analysis of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml

Sandwich ELISA: TAF11 Antibody (2G9) [H00006882-M04] - Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
• Clone: 2G9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

TAF11 Antibody (2G9) Summary

• Immunogen: TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF
• Specificity: TAF11 (2G9)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TAF11
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAF11 Antibody (2G9)

• 28kDa
• TAF(II)28
• TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TAF2IMGC:15243
• TAFII-28
• TAFII28TFIID subunit p30-beta
• TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD
• transcription initiation factor TFIID 28 kD subunit
• Transcription initiation factor TFIID 28 kDa subunit
• transcription initiation factor TFIID subunit 11

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF11
• Entrez:
  • 6882(Human)
• OMIM:
  • 600772(Human)
• Uniprot:
  • NP_005634(Human)