TAB1 Antibody (2A12) - Azide and BSA Free

Western Blot: TAB1 Antibody (2A12) [H00010454-M03] - Analysis of MAP3K7IP1 expression in HeLa (Cat # L013V1).

Immunocytochemistry/Immunofluorescence: TAB1 Antibody (2A12) [H00010454-M03] - Analysis of monoclonal antibody to MAP3K7IP1 on HeLa cell. Antibody concentration 10 ug/ml

Western Blot: TAB1 Antibody (2A12) [H00010454-M03] - Analysis of MAP3K7IP1 expression in PC-12 (Cat # L012V1).

ELISA: TAB1 Antibody (2A12) [H00010454-M03] - Detection limit for recombinant GST tagged MAP3K7IP1 is approximately 0.3ng/ml as a capture antibody.

Proximity Ligation Assay: TAB1 Antibody (2A12) [H00010454-M03] - Analysis of protein-protein interactions between HSPA1L and MAP3K7IP1 HeLa cells were stained with anti-HSPA1L rabbit purified polyclonal 1:1200 and anti-MAP3K7IP1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

• Reactivity: Hu, Rt
• Applications: WB, ELISA, Func, ICC/IF
• Clone: 2A12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TAB1 Antibody (2A12) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse TAB1 Antibody (2A12) - Azide and BSA Free (H00010454-M03) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MAP3K7IP1 (NP_705717.1, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA
• Specificity: MAP3K7IP1 (2A12)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TAB1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Proximity Ligation Assay
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAB1 Antibody (2A12) - Azide and BSA Free

• MAP3K7IP1
• MAP3K7IP13'-Tab1
• MGC57664
• mitogen-activated protein kinase kinase kinase 7 interacting protein 1
• Mitogen-activated protein kinase kinase kinase 7-interacting protein 1
• TAB1
• TAK1-binding protein 1
• TGF-beta activated kinase 1/MAP3K7 binding protein 1
• TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
• TGF-beta-activated kinase 1-binding protein 1
• transforming growth factor beta-activated kinase-binding protein 1

Background

The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for TAB1 Antibody (H00010454-M03). (Showing 1 - 1 of 1 FAQ).

1. Why is there double band in the blot using TAB1(2A12) antibody?
   • Human TAB1 has two isoforms with predicted molecular weights of 54.6 kDa and 49.9 kDa. And the immunogen of H00010454-M03 has 100% similarity with the sequences of both isoforms of Human TAB1. Therefore, we believe that the cause of double band seen in the validation image of H00010454-M03 is related to two isoforms of TAB1 protein existing in HeLa cell lysate.

Bioinformatics

• Gene Symbol: TAB1
• Entrez:
  • 10454(Human)
• OMIM:
  • 602615(Human)
• Uniprot:
  • NP_705717(Human)