SYT9 Antibody - BSA Free

Western Blot: SYT9 Antibody [NBP2-82352] - Host: Rabbit. Target Name: SYT9. Sample Type: MCF7 Whole cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SYT9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SYT9 Antibody - BSA Free (NBP2-82352) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human SYT9. Peptide sequence: PLNYMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQTGIQEN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYT9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SYT9 Antibody - BSA Free

• synaptotagmin IXFLJ45896
• synaptotagmin-9
• sytIX

Background

SYT9 may be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid bindingto the C2 domain or may serve as Ca(2+) sensors in the processof vesicular trafficking and exocytosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYT9