SYT10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SYT10 Antibody [NBP2-31604] - Staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.
Immunohistochemistry: SYT10 Antibody [NBP2-31604] - Staining of human pancreas shows strong cytoplasmic positivity in subset of cells in islets of Langerhans.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SYT10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDIS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYT10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SYT10 Protein (NBP2-31604PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SYT10 Antibody

  • synaptotagmin-10
  • synaptotagmin X

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP1-60112
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81588
Species: Hu
Applications: WB, IHC, IHC-P
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
AF5085
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-31604
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SYT10 Antibody (NBP2-31604) (0)

There are no publications for SYT10 Antibody (NBP2-31604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SYT10 Antibody (NBP2-31604) (0)

There are no reviews for SYT10 Antibody (NBP2-31604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SYT10 Antibody (NBP2-31604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SYT10 Products

Bioinformatics Tool for SYT10 Antibody (NBP2-31604)

Discover related pathways, diseases and genes to SYT10 Antibody (NBP2-31604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYT10 Antibody (NBP2-31604)

Discover more about diseases related to SYT10 Antibody (NBP2-31604).
 

Pathways for SYT10 Antibody (NBP2-31604)

View related products by pathway.

Blogs on SYT10

There are no specific blogs for SYT10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SYT10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYT10
Uniprot