SYT15 Antibody

Images

 
Immunohistochemistry: SYT15 Antibody [NBP2-30856] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SYT15 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HARTQLSRPPAVPFVVPPTLQGRDWVPLHSGEWADAPWDPCPASELLPHTSSGGLGDACMVGAINPELYKFPEDKSETDFPDGC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYT15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SYT15 Protein (NBP2-30856PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SYT15 Antibody

  • synaptotagmin-15
  • CHR10SYT
  • synaptotagmin XV
  • sytXV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24567
Species: Hu
Applications: WB
NBP2-45844
Species: Hu
Applications: WB, IHC
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
AF6146
Species: Hu
Applications: ICC
NBP1-80533
Species: Mu
Applications: WB
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-78758
Species: Hu
Applications: WB (-), IP
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
H00004061-D01P
Species: Hu
Applications: WB

Publications for SYT15 Antibody (NBP2-30856) (0)

There are no publications for SYT15 Antibody (NBP2-30856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SYT15 Antibody (NBP2-30856) (0)

There are no reviews for SYT15 Antibody (NBP2-30856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SYT15 Antibody (NBP2-30856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SYT15 Products

Bioinformatics Tool for SYT15 Antibody (NBP2-30856)

Discover related pathways, diseases and genes to SYT15 Antibody (NBP2-30856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYT15 Antibody (NBP2-30856)

Discover more about diseases related to SYT15 Antibody (NBP2-30856).

Blogs on SYT15

There are no specific blogs for SYT15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SYT15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYT15
Uniprot