Syntaxin Binding Protein 4 Recombinant Protein Antigen

Images

 
There are currently no images for Syntaxin Binding Protein 4 Protein (NBP1-92471PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Syntaxin Binding Protein 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STXBP4.

Source: E. coli

Amino Acid Sequence: TPLGRNGRSIPATLALESKELVKSVRALLDMDCLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMSVLNLSRSEENEEDCSRELPNQK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STXBP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92471.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Syntaxin Binding Protein 4 Recombinant Protein Antigen

  • FLJ16496
  • MGC50337
  • STX4-interacting protein
  • SynipMGC149829
  • syntaxin 4 interacting protein
  • Syntaxin 4-interacting protein
  • syntaxin binding protein 4
  • syntaxin-binding protein 4

Background

Synip (Syntaxin 4-Interacting protein) specifically binds to Syntaxin 4 and is uniquely expressed in muscle and adipose tissue. The binding interaction of Synip with syntaxin 4 is regulated by insulin, which also induces dissociation of the Synip-syntaxin 4 complex. Synip plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane and functions as a positive regulator of insulin-stimulated GLUT4 translocation. Synip also competes with VAMP2 but Not SNAP23 for binding to Syntaxin 4 (1-3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-87374
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB300-595
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47657
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF23151
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP3-15706
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-20434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-74462
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP3-10064
Species: Hu
Applications: WB
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF5659
Species: Hu
Applications: WB
NBP1-20944
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP3-47544
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-45165
Species: Ch, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PA, WB
NBP1-92471PEP
Species: Hu
Applications: AC

Publications for Syntaxin Binding Protein 4 Protein (NBP1-92471PEP) (0)

There are no publications for Syntaxin Binding Protein 4 Protein (NBP1-92471PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin Binding Protein 4 Protein (NBP1-92471PEP) (0)

There are no reviews for Syntaxin Binding Protein 4 Protein (NBP1-92471PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Syntaxin Binding Protein 4 Protein (NBP1-92471PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Syntaxin Binding Protein 4 Products

Research Areas for Syntaxin Binding Protein 4 Protein (NBP1-92471PEP)

Find related products by research area.

Blogs on Syntaxin Binding Protein 4

There are no specific blogs for Syntaxin Binding Protein 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Syntaxin Binding Protein 4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STXBP4