Synaptotagmin 2 Antibody


Western Blot: Synaptotagmin 2 Antibody [NBP1-69187] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Synaptotagmin 2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Synaptotagmin 2 Antibody Summary

Synthetic peptides corresponding to SYT2 (synaptotagmin II) The peptide sequence was selected from the C terminal of SYT2. Peptide sequence AIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SYT2 and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Synaptotagmin 2 Antibody

  • FLJ42519
  • synaptotagmin 2
  • synaptotagmin IISytII
  • synaptotagmin-2


Synaptotagmins, like SYT2, are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (Hilbush and Morgan, 1994 [PubMed 8058779]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Bv
Applications: WB, ICC/IF, IHC
Species: Hu
Species: Mu, Rt, Fi, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Synaptotagmin 2 Antibody (NBP1-69187) (0)

There are no publications for Synaptotagmin 2 Antibody (NBP1-69187).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptotagmin 2 Antibody (NBP1-69187) (0)

There are no reviews for Synaptotagmin 2 Antibody (NBP1-69187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synaptotagmin 2 Antibody (NBP1-69187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Synaptotagmin 2 Products

Bioinformatics Tool for Synaptotagmin 2 Antibody (NBP1-69187)

Discover related pathways, diseases and genes to Synaptotagmin 2 Antibody (NBP1-69187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptotagmin 2 Antibody (NBP1-69187)

Discover more about diseases related to Synaptotagmin 2 Antibody (NBP1-69187).

Pathways for Synaptotagmin 2 Antibody (NBP1-69187)

View related products by pathway.

PTMs for Synaptotagmin 2 Antibody (NBP1-69187)

Learn more about PTMs related to Synaptotagmin 2 Antibody (NBP1-69187).

Research Areas for Synaptotagmin 2 Antibody (NBP1-69187)

Find related products by research area.

Blogs on Synaptotagmin 2

There are no specific blogs for Synaptotagmin 2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Synaptotagmin 2 Antibody and receive a gift card or discount.


Gene Symbol SYT2