Synaptojanin 2 Recombinant Protein Antigen

Images

 
There are currently no images for Synaptojanin 2 Protein (NBP1-87843PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Synaptojanin 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SYNJ2.

Source: E.coli

Amino Acid Sequence: HGQYSILQTARLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGASEEALSAVAPRDLEASSEP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SYNJ2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87843.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Synaptojanin 2 Recombinant Protein Antigen

  • EC 3.1.3.36
  • inositol phosphate 5'-phosphatase 2
  • INPP5H
  • KIAA0348MGC44422
  • Synaptic inositol-14,5-trisphosphate 5-phosphatase 2
  • synaptojanin 2
  • synaptojanin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87842
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-87086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33533
Species: Hu
Applications: WB, IHC, IHC-P
NB110-94158
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IP
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-58314
Species: Hu
Applications: IHC, IHC-P
NBP2-67091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003636-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86033
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24717
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-88985
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46587
Species: Hu
Applications: WB, IHC
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Synaptojanin 2 Protein (NBP1-87843PEP) (0)

There are no publications for Synaptojanin 2 Protein (NBP1-87843PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptojanin 2 Protein (NBP1-87843PEP) (0)

There are no reviews for Synaptojanin 2 Protein (NBP1-87843PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Synaptojanin 2 Protein (NBP1-87843PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Synaptojanin 2 Products

Bioinformatics Tool for Synaptojanin 2 Protein (NBP1-87843PEP)

Discover related pathways, diseases and genes to Synaptojanin 2 Protein (NBP1-87843PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptojanin 2 Protein (NBP1-87843PEP)

Discover more about diseases related to Synaptojanin 2 Protein (NBP1-87843PEP).
 

Pathways for Synaptojanin 2 Protein (NBP1-87843PEP)

View related products by pathway.

PTMs for Synaptojanin 2 Protein (NBP1-87843PEP)

Learn more about PTMs related to Synaptojanin 2 Protein (NBP1-87843PEP).
 

Research Areas for Synaptojanin 2 Protein (NBP1-87843PEP)

Find related products by research area.

Blogs on Synaptojanin 2

There are no specific blogs for Synaptojanin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAT2A Antibody
NB110-94158

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Synaptojanin 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNJ2