Synaptogyrin 2 Antibody (1G7) - Azide and BSA Free

Western Blot: Synaptogyrin 2 Antibody (1G7) [H00009144-M03] - Detection against Immunogen (32.01 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1G7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Synaptogyrin 2 Antibody (1G7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Synaptogyrin 2 Antibody (1G7) - Azide and BSA Free (H00009144-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SYNGR2 (NP_004701, 168 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SYNGR2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Synaptogyrin 2 Antibody (1G7) - Azide and BSA Free

• cellugyrin
• MGC102914
• synaptogyrin 2
• synaptogyrin-2

Background

This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells. The gene belongs to the synaptogyrin gene family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYNGR2
• Uniprot:
  • NP_004701(Human)