SYDE1 Antibody - BSA Free

Western Blot: SYDE1 Antibody [NBP1-57607] - Lanes: 1: 2ug mouse SYDE1 transfected HEK293T lysate, 2: 15ug untransfected HEK293T lysate, 3: 100ug wild type mouse brain lysate, 4: 100ug SYDE1 knock-out mouse brain lysate Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit L-chain HRP Sec

Western Blot: SYDE1 Antibody [NBP1-57607] - Hela, Antibody Dilution: 1.0 ug/ml SYDE1 is supported by BioGPS gene expression data to be expressed in HeLa.

Western Blot: SYDE1 Antibody [NBP1-57607] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SYDE1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SYDE1(synapse defective 1, Rho GTPase, homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of SYDE1. Peptide sequence PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYDE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockout Validated
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SYDE1 Antibody - BSA Free

• EC 2.4.1.25
• EC 2.6.1.9
• FLJ13511
• Protein syd-1 homolog 1
• rho GTPase-activating protein SYDE1
• synapse defective 1, Rho GTPase, homolog 1 (C. elegans)
• Synapse defective protein 1 homolog 1,7h3

Background

SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SYDE1 Antibody (NBP1-57607)(3)

Publications using NBP1-57607

• Maji S, Pirozzi M, Ruturaj et al. Copper-independent lysosomal localisation of the Wilson disease protein ATP7B Traffic (Copenhagen, Denmark) 2023-10-17 [PMID: 37846526] (WB, Mouse)
• Xu H, Yang H, Wang Z et al. Epidermal stem cell derived exosomes alleviate excessive autophagy induced endothelial cell apoptosis by delivering miR200b-3p to diabetic wounds The Journal of investigative dermatology 2023-10-12 [PMID: 37838331] (WB, Rat)
• Xu h, Wang Z, Yang H et al. Epidermal stem cell-derived exosomes alleviate autophagy induced endothelial cell apoptosis through miR200b-3p/ERK pathway in diabetic wounds Research Square 2022-06-16 (WB, Mouse)

Bioinformatics

• Gene Symbol: SYDE1
• Uniprot:
  • Q6ZW31(Human)