SYCE1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse SYCE1. Peptide sequence: QHEQLQQRCHQLQQKRQRLKEELEKHGVQILAHSTQNEEDSSWRMASPKP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SYCE1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for SYCE1 Antibody - BSA Free
Background
Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologouschromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have arole in the synaptonemal complexe assembly, stabilization and recombination
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Av, Bv, Sh
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt, RM
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Publications for SYCE1 Antibody (NBP2-85848) (0)
There are no publications for SYCE1 Antibody (NBP2-85848).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SYCE1 Antibody (NBP2-85848) (0)
There are no reviews for SYCE1 Antibody (NBP2-85848).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SYCE1 Antibody (NBP2-85848) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SYCE1 Products
Research Areas for SYCE1 Antibody (NBP2-85848)
Find related products by research area.
|
Blogs on SYCE1