Recombinant Human SV2A GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human SV2A Protein [H00009900-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human SV2A GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 474-530 of Human SV2A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HLQAVDYASRTKVFPGERVGHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SV2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
32.01 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SV2A GST (N-Term) Protein

  • KIAA0736
  • KIAA0736SV2
  • SV2
  • SV2A
  • synaptic vesicle glycoprotein 2A

Background

SV2A - synaptic vesicle glycoprotein 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-653
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86239
Species: Hu
Applications: IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-45499
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91348
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP2-46640
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for SV2A Partial Recombinant Protein (H00009900-Q01) (0)

There are no publications for SV2A Partial Recombinant Protein (H00009900-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SV2A Partial Recombinant Protein (H00009900-Q01) (0)

There are no reviews for SV2A Partial Recombinant Protein (H00009900-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SV2A Partial Recombinant Protein (H00009900-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SV2A Products

Bioinformatics Tool for SV2A Partial Recombinant Protein (H00009900-Q01)

Discover related pathways, diseases and genes to SV2A Partial Recombinant Protein (H00009900-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SV2A Partial Recombinant Protein (H00009900-Q01)

Discover more about diseases related to SV2A Partial Recombinant Protein (H00009900-Q01).
 

Pathways for SV2A Partial Recombinant Protein (H00009900-Q01)

View related products by pathway.

PTMs for SV2A Partial Recombinant Protein (H00009900-Q01)

Learn more about PTMs related to SV2A Partial Recombinant Protein (H00009900-Q01).

Blogs on SV2A

There are no specific blogs for SV2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SV2A Antibody
NBP1-82964
Synapsin I Antibody
NB300-104-100ul

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SV2A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SV2A