Recombinant Human SURF5 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SURF5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human SURF5

Source: Wheat Germ

Amino Acid Sequence: MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MED22
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SURF5 Protein

  • Med24
  • mediator complex subunit 22SURF5surfeit 5
  • mediator of RNA polymerase II transcription subunit 22
  • MGC48682
  • surf-5
  • Surfeit locus protein 5

Background

This gene is located in the surfeit gene cluster, a group of very tightly linked housekeeping genes that do not share sequence similarity. The gene is oriented in a head-to-head fashion with RPL7A (SURF3) and the two genes share a bidirectional promoter. The encoded proteins are localized to the cytoplasm. Two alternative transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2277
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-65783
Species: Hu
NBP2-13400
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20537
Species: Hu
Applications: WB
NBP1-83550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91189
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NBP2-56318
Species: Hu
Applications: ICC/IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP1-84377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00008706-P01
Species: Hu
H00006837-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SURF5 Partial Recombinant Protein (H00006837-Q01) (0)

There are no publications for SURF5 Partial Recombinant Protein (H00006837-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SURF5 Partial Recombinant Protein (H00006837-Q01) (0)

There are no reviews for SURF5 Partial Recombinant Protein (H00006837-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SURF5 Partial Recombinant Protein (H00006837-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SURF5 Products

Bioinformatics Tool for SURF5 Partial Recombinant Protein (H00006837-Q01)

Discover related pathways, diseases and genes to SURF5 Partial Recombinant Protein (H00006837-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SURF5 Partial Recombinant Protein (H00006837-Q01)

Discover more about diseases related to SURF5 Partial Recombinant Protein (H00006837-Q01).
 

Pathways for SURF5 Partial Recombinant Protein (H00006837-Q01)

View related products by pathway.

PTMs for SURF5 Partial Recombinant Protein (H00006837-Q01)

Learn more about PTMs related to SURF5 Partial Recombinant Protein (H00006837-Q01).

Blogs on SURF5

There are no specific blogs for SURF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SURF5 Antibody
NBP1-87818

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SURF5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MED22