Home » STRN4 » STRN4 Proteins » STRN4 Recombinant Protein Antigen

STRN4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for STRN4 Recombinant Protein Antigen (NBP2-55532PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

STRN4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STRN4.

Source: E.coli

Amino Acid Sequence: GLSGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLGQIPFLQNCEDEDSDEDDELDSVQHKKQRVKLPSKALVPEMEDE
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STRN4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55532. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for STRN4 Recombinant Protein Antigen

  • FLJ35594
  • striatin, calmodulin binding protein 4
  • striatin-4
  • ZIN
  • zinedin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Striatin Antibody
NB110-74571
Immunocytochemistry/Immunofluorescence: Striatin Antibody [NB110-74571] - Immunofluorescent staining of NIH3T3 cells ± blocking peptide using NB110-74571.
Western Blot: Striatin Antibody [NB110-74571] - Immunoblot of PP2A immunoprecipitate with NB110-74571.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
SG2NA Antibody
(S68)
NB110-74572
Immunocytochemistry/Immunofluorescence: SG2NA Antibody (S68) [NB110-74572] - Immunofluorescent staining of NIH3T3 cells using NB110-74572.
Western Blot: SG2NA Antibody (S68) [NB110-74572] - Detection of SG2NA in NIH3T3 cell lysates using NB110-74572.
Immunocytochemistry/Immunofluorescence: SG2NA Antibody (S68) [NB110-74572] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-SG2NA (S68) [NB110-74572] at a 1:50 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
MAP4K6 Antibody
NBP1-22990
Western Blot: MAP4K6 Antibody [NBP1-22990] - Wole cell lysate from HeLa and mouse NIH3T3 cells at 0.04 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate.
(5 Publications)
Species: Hu, Mu
Applications: IP, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Calmodulin antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.A2058 melanoma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. C6 glioma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. HeLa Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(738 Publications)
Species: Hu
Applications: BA
PPP2R4 Antibody
NBP1-87232
Western Blot: PPP2R4 Antibody [NBP1-87232] - Analysis in human cell line SiHa.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TRIAD3 Antibody
NBP1-86907
Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts and leydig cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
RIPK1/RIP1
Antibody - BSA Free
NBP1-77077
Immunocytochemistry/Immunofluorescence: RIPK1/RIP1 Antibody [NBP1-77077] - Mouse Kidney cells with RIPK1 antibody at 20 ug/mL.
Western Blot: RIPK1/RIP1 Antibody [NBP1-77077] - At 6 h after CCI, RIP1 protein levels in the cortex detected by western blotting were decreased in Nec-1 and melatonin pretreatment groups, but there was no change in the Z-VAD pretreatment group. Values are represented as means +/- SEM (n = 3). B-actin was used as a control in western blot assays. All data were analyzed by one way ANOVA plus Tukey's test. *P < 0.05 and **P < 0.01 vs. CCI group. Image collected and cropped by CiteAb from the following publication (https://www.frontiersin.org/article/10.3389/fnmol.2019.00222/full) licensed under a CC-BY licence.
Immunohistochemistry: RIPK1/RIP1 Antibody [NBP1-77077] - Traumatic brain injury (TBI) tissues show increased necroptosis compared with normal brain tissues (NBTs). The expression of RIP1 was tested in NBT and TBI tissues from Jiangsu Province Hospital by immunohistochemistry. Image collected and cropped by CiteAb from the following publication (https://www.frontiersin.org/article/10.3389/fnmol.2019.00222/full) licensed under a CC-BY licence.
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Caveolin-1
Antibody (7C8)
NB100-615
Flow Cytometry: Caveolin-1 Antibody (7C8) [NB100-615] - An intracellular stain was performed on HeLa cells with Caveolin-1 Antibody (7C8) NB100-615 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Flow Cytometry: Caveolin-1 Antibody (7C8) [NB100-615] - An intracellular stain was performed on HeLa cells with Caveolin-1 Antibody (7C8) NB100-615APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to allophycocyanin.
Immunocytochemistry/Immunofluorescence: Caveolin-1 Antibody (7C8) [NB100-615] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-Caveolin-1 [7C8] conjugated to Alexa Fluor 488 (NB100-615AF488) at 20 ug/mL for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTTNBP2NL Antibody
NBP1-84171
Immunohistochemistry-Paraffin: CTTNBP2NL Antibody [NBP1-84171] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: CTTNBP2NL Antibody [NBP1-84171] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & cytosol. Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Prolactin Antibody
[Unconjugated]
AF682
Recombinant Human Prolactin (Catalog # 682-PL) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Prolactin (0.5 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682). The ND50 is typically 0.02-0.05 µg/mL.
Prolactin was detected in immersion fixed paraffin-embedded sections of human testis using Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of sperm cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pituitary tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Prolactin at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) - Azide and BSA Free [MAB9167] - Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Mouse IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils .
Flow Cytometry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - THP-1 human acute monocytic leukemia cell line treated with 3 uM monensin for 3 hours was stained with Mouse Anti-Human Neutrophil Elastase/ELA2 Monoclonal Antibody (Catalog # MAB9167, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005).
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
PP2A alpha [p
Tyr307] Antibody [Unc ...
AF3989
Western blot shows lysates of A549 human lung carcinoma cell line untreated (-) or treated (+) with hydroxyurea. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-PP2A (Y307), Catalytic Subunit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3989), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-PP2A (Y307), Catalytic Subunit at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB

Publications for STRN4 Recombinant Protein Antigen (NBP2-55532PEP) (0)

There are no publications for STRN4 Recombinant Protein Antigen (NBP2-55532PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STRN4 Recombinant Protein Antigen (NBP2-55532PEP) (0)

There are no reviews for STRN4 Recombinant Protein Antigen (NBP2-55532PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STRN4 Recombinant Protein Antigen (NBP2-55532PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STRN4 Products

Array NBP2-55532PEP

Bioinformatics Tool for STRN4 Recombinant Protein Antigen (NBP2-55532PEP)

Discover related pathways, diseases and genes to STRN4 Recombinant Protein Antigen (NBP2-55532PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STRN4 Recombinant Protein Antigen (NBP2-55532PEP)

Discover more about diseases related to STRN4 Recombinant Protein Antigen (NBP2-55532PEP).
 

Pathways for STRN4 Recombinant Protein Antigen (NBP2-55532PEP)

View related products by pathway.

Research Areas for STRN4 Recombinant Protein Antigen (NBP2-55532PEP)

Find related products by research area.

Blogs on STRN4

There are no specific blogs for STRN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: Caveolin-1 Antibody (7C8) [NB100-615] - An intracellular stain was performed on HeLa cells with Caveolin-1 Antibody (7C8) NB100-615 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Caveolin-1 Antibody (7C8)
NB100-615

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STRN4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol STRN4