Striatin Antibody - BSA Free

Western Blot: Striatin Antibody [NBP2-85841] - Host: Rabbit. Target Name: Strn3. Sample Type: Mouse Brain lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Striatin Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of mouse Striatin. Peptide sequence: RFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STRN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Striatin Antibody - BSA Free

• MGC125642
• SG2NA
• striatin
• striatin, calmodulin binding protein
• striatin, calmodulin-binding protein

Background

Striatin is a calmodulin-binding protein which may function as scaffolding or signaling protein and may play a role in dendritic Ca2+ signaling. Striatin is localized in the somato-dendritic compartment of neurons, mainly in the spines. There is much interest to study striatin localization and function in the human CNS and its possible involvement in neurological diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STRN