Stomatin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Stomatin Antibody [NBP1-88562] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Stomatin Antibody [NBP1-88562] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Stomatin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STOM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Stomatin Protein (NBP1-88562PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Stomatin Antibody

  • BND7EPB7
  • EPB72erythrocyte band 7 integral membrane protein
  • erythrocyte membrane protein band 7.2 (stomatin)
  • Protein 7.2b
  • Stomatin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45464
Species: Hu
Applications: WB, IHC
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92455
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79022
Species: Hu, Mu
Applications: WB, IP
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP1-30881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
20760002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24479
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-13968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20245
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-49180
Species: Hu
Applications: IHC
NBP1-88562
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Stomatin Antibody (NBP1-88562) (0)

There are no publications for Stomatin Antibody (NBP1-88562).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Stomatin Antibody (NBP1-88562) (0)

There are no reviews for Stomatin Antibody (NBP1-88562). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Stomatin Antibody (NBP1-88562) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Stomatin Products

Bioinformatics Tool for Stomatin Antibody (NBP1-88562)

Discover related pathways, diseases and genes to Stomatin Antibody (NBP1-88562). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Stomatin Antibody (NBP1-88562)

Discover more about diseases related to Stomatin Antibody (NBP1-88562).
 

Pathways for Stomatin Antibody (NBP1-88562)

View related products by pathway.

PTMs for Stomatin Antibody (NBP1-88562)

Learn more about PTMs related to Stomatin Antibody (NBP1-88562).

Blogs on Stomatin

There are no specific blogs for Stomatin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Stomatin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STOM
Entrez
Uniprot