We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

STK35 Recombinant Protein Antigen

Images

 
There are currently no images for STK35 Protein (NBP2-30644PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STK35 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK35.

Source: E. coli

Amino Acid Sequence: TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STK35
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30644.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STK35 Recombinant Protein Antigen

  • bA550O8.2
  • CLIK-1
  • CLIK1Serine/threonine-protein kinase 35 L1
  • CLP-36 interacting kinase
  • CLP-36-interacting kinase 1
  • EC 2.7.11
  • EC 2.7.11.1
  • PDIK1
  • PDLIM1-interacting kinase 1
  • serine threonine kinase 35 long form
  • serine/threonine kinase 35
  • serine/threonine-protein kinase 35
  • STK35L1

Background

STK35 associates with the PDZ-LIM protein CLP36 through the LIM domain and undergoes autophosphorylation in vitro. STK35 localizes predominantly to the nucleus; however, cotransfection of STK35 with CLP36 demonstrated redistribution of STK35 to the cytoplasm and into actin stress fibers, where it colocalizes with CLP36. The presence of STK35 disrupted the periodic staining pattern of CLP36 in these fibers. It is suggested that CLP36 specifically targets STK35 to actin stress fibers and that STK35 may represent a regulator of the actomyosin cytoskeleton in nonmuscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00149420-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-84443
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-23662
Species: Hu
Applications: Flow, ICC/IF,  IHC-P
NBP1-88809
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP1-31362
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
DCC270
Species: Hu
Applications: ELISA
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15253
Species: Mu, Rt
Applications: WB
NBP2-30644PEP
Species: Hu
Applications: AC

Publications for STK35 Protein (NBP2-30644PEP) (0)

There are no publications for STK35 Protein (NBP2-30644PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK35 Protein (NBP2-30644PEP) (0)

There are no reviews for STK35 Protein (NBP2-30644PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STK35 Protein (NBP2-30644PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STK35 Products

Research Areas for STK35 Protein (NBP2-30644PEP)

Find related products by research area.

Blogs on STK35

There are no specific blogs for STK35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STK35 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STK35