STK19 Antibody

Product Discontinued

STK19 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIKYFVKGRQAVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK19
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for STK19 Antibody

• D6S60
• D6S60E
• EC 2.7.11.1
• G11nuclear serine/threonine protein kinase
• HLA-RP1
• MGC117388
• MHC class III HLA-RP1
• Protein G11
• Protein RP1
• RP1serine/threonine-protein kinase 19
• serine/threonine kinase 19

Background

STK19 encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for STK19 Antibody (NBP2-33955)(2)

Publications using NBP2-33955

• RodrIguez-MartInez M, BoissiEre T, Noe Gonzalez M et al. Evidence That STK19 Is Not an NRAS-dependent Melanoma Driver Cell 2020-06-11 [PMID: 32531245] (WB, Human)
• Yin C, Zhu B, Zhang T et al. Pharmacological Targeting of STK19 Inhibits Oncogenic NRAS-Driven Melanomagenesis Cell 2019-02-21 [PMID: 30712867] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: STK19
• Uniprot:
  • P49842(Human)