STARD3 Recombinant Protein Antigen

Images

 
There are currently no images for STARD3 Recombinant Protein Antigen (NBP3-17314PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STARD3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STARD3

Source: E. coli

Amino Acid Sequence: LPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STARD3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17314.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STARD3 Recombinant Protein Antigen

  • CAB1
  • es64
  • Metastatic lymph node gene 64 protein
  • metastatic lymph node protein 64
  • MLN 64
  • MLN64FLJ41370
  • Protein CAB1
  • StARD3
  • StAR-related lipid transfer (START) domain containing 3
  • stAR-related lipid transfer protein 3
  • START domain containing 3
  • START domain-containing protein 3
  • steroidogenic acute regulatory protein related

Background

The steroidogenic acute regulatory (StAR) protein facilitates the movement of cholesterol from the outer to inner mitochondrial membrane in adrenal and gonadal cells, fostering steroid biosynthesis. MLN 64 is a 445-amino acid protein of unknown function. When 218 amino-terminal residues of MLN 64 are deleted, the resulting N-218 MLN 64 has 37% amino acid identity with StAR and 50% of StAR's steroidogenic activity in transfected cells. Bacterially expressed N-218 MLN 64 exerts StAR-like activity to promote the transfer of cholesterol from the outer to inner mitochondrial membrane in vitro. The presence of a protease-resistant domain and a protease-sensitive carboxy-terminal domain in N-218 MLN 64 is similar to the organization of StAR. However, as MLN 64 never enters the mitochondria, the protease-resistant domain of MLN 64 cannot be a mitochondrial pause-transfer sequence, as has been proposed for StAR.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
1129-ER
Species: Hu
Applications: BA
AF4856
Species: Hu, Mu, Rt
Applications: IHC, WB
664-LI
Species: Hu
Applications: BA
NBP3-12196
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC,  IHC-P, IP, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92448
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP2-00688
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13954
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-93527
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF5489
Species: Hu
Applications: IHC, WB
NBP1-86680
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-30538
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB4230
Species: Mu, Rt
Applications: IHC, WB
NBP1-84012
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-59580
Species: Hu, Rt
Applications: WB

Publications for STARD3 Recombinant Protein Antigen (NBP3-17314PEP) (0)

There are no publications for STARD3 Recombinant Protein Antigen (NBP3-17314PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD3 Recombinant Protein Antigen (NBP3-17314PEP) (0)

There are no reviews for STARD3 Recombinant Protein Antigen (NBP3-17314PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STARD3 Recombinant Protein Antigen (NBP3-17314PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STARD3 Products

Research Areas for STARD3 Recombinant Protein Antigen (NBP3-17314PEP)

Find related products by research area.

Blogs on STARD3

There are no specific blogs for STARD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STARD3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD3