Recombinant Human STARD3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STARD3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 371-445 of Human STARD3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
STARD3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STARD3 Protein

  • CAB1
  • es64
  • Metastatic lymph node gene 64 protein
  • metastatic lymph node protein 64
  • MLN 64
  • MLN64FLJ41370
  • Protein CAB1
  • StARD3
  • StAR-related lipid transfer (START) domain containing 3
  • stAR-related lipid transfer protein 3
  • START domain containing 3
  • START domain-containing protein 3
  • steroidogenic acute regulatory protein related

Background

Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD3 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4856
Species: Hu, Mu, Rt
Applications: WB
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92448
Species: Hu
Applications: WB, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93527
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
AF5489
Species: Hu
Applications: WB, IHC
H00000783-M05
Species: Hu, Mu
Applications: WB, ELISA
NBP2-30538
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB

Publications for STARD3 Partial Recombinant Protein (H00010948-Q01) (0)

There are no publications for STARD3 Partial Recombinant Protein (H00010948-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD3 Partial Recombinant Protein (H00010948-Q01) (0)

There are no reviews for STARD3 Partial Recombinant Protein (H00010948-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STARD3 Partial Recombinant Protein (H00010948-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STARD3 Products

Bioinformatics Tool for STARD3 Partial Recombinant Protein (H00010948-Q01)

Discover related pathways, diseases and genes to STARD3 Partial Recombinant Protein (H00010948-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD3 Partial Recombinant Protein (H00010948-Q01)

Discover more about diseases related to STARD3 Partial Recombinant Protein (H00010948-Q01).
 

Pathways for STARD3 Partial Recombinant Protein (H00010948-Q01)

View related products by pathway.

PTMs for STARD3 Partial Recombinant Protein (H00010948-Q01)

Learn more about PTMs related to STARD3 Partial Recombinant Protein (H00010948-Q01).
 

Research Areas for STARD3 Partial Recombinant Protein (H00010948-Q01)

Find related products by research area.

Blogs on STARD3

There are no specific blogs for STARD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STARD3 Antibody (1D1)
H00010948-M01
ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STARD3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD3