STAG3 Antibody

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-47258] - Analysis in human testis and kidney tissues using NBP2-47258 antibody. Corresponding STAG3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-47258] - Staining of human cerebral cortex, kidney, stomach and testis using Anti-STAG3 antibody NBP2-47258 (A) shows similar protein distribution across tissues to independent antibody NBP2-38851 (B).

Western Blot: STAG3 Antibody [NBP2-47258] - Analysis in human cell line BEWO.

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-47258] - Staining of human kidney.

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-47258] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-47258] - Staining of human stomach using Anti-STAG3 antibody NBP2-47258.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

STAG3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DRDSNHTSEGNGDSLLADEDTDFEDSLNRNVKKRAAKRPPKTTPVAKHPKKGSRVVHRHSRKQSEPPANDLFNAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAG3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence -Reported in scientific literature (PMID: 30701021).
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  STAG3 Protein (NBP2-47258PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for STAG3 Antibody

• cohesin subunit SA-3
• SCC3 homolog 3
• stromal antigen 3stromalin 3
• stromalin-3

Background

Meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for STAG3 Antibody (NBP2-47258)(1)

Publication using NBP2-47258

• Tsang M, Gantchev J, Netchiporouk E et al. A study of meiomitosis and novel pathways of genomic instability in cutaneous T-cell lymphomas (CTCL) Oncotarget 2018-12-28 [PMID: 30701021] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: STAG3