ST6GALNAC3 Antibody

Images

 
Western Blot: ST6GALNAC3 Antibody [NBP1-69326] - This Anti-ST6GALNAC3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST6GALNAC3 Antibody Summary

Immunogen
Synthetic peptides corresponding to ST6GALNAC3(ST6-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3) The peptide sequence was selected from the C terminal of ST6GALNAC3. Peptide sequence HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GALNAC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ST6GALNAC3 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST6GALNAC3 Antibody

  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III
  • EC 2.4.99.-
  • EC 2.4.99.7
  • FLJ13669
  • FLJ27239
  • GalNAc alpha-2,6-sialyltransferase III
  • PRO7177
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C
  • Sialyltransferase 7C
  • SIAT7C
  • SIAT7-C
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3
  • ST6GalNAc III
  • ST6GALNACIII
  • STY

Background

ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids (Lee et al., 1999 [PubMed 10207017]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
6876-GT
Species: Hu
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00006732-M01
Species: Hu
Applications: WB, ELISA, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
MAB6715
Species: Hu
Applications: WB
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P

Publications for ST6GALNAC3 Antibody (NBP1-69326) (0)

There are no publications for ST6GALNAC3 Antibody (NBP1-69326).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6GALNAC3 Antibody (NBP1-69326) (0)

There are no reviews for ST6GALNAC3 Antibody (NBP1-69326). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST6GALNAC3 Antibody (NBP1-69326) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST6GALNAC3 Products

Bioinformatics Tool for ST6GALNAC3 Antibody (NBP1-69326)

Discover related pathways, diseases and genes to ST6GALNAC3 Antibody (NBP1-69326). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6GALNAC3 Antibody (NBP1-69326)

Discover more about diseases related to ST6GALNAC3 Antibody (NBP1-69326).
 

Pathways for ST6GALNAC3 Antibody (NBP1-69326)

View related products by pathway.

Blogs on ST6GALNAC3

There are no specific blogs for ST6GALNAC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6GALNAC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GALNAC3
Uniprot