ST6 Sialyltransferase 2/ST6GALNAC2 Antibody

Images

 
Immunohistochemistry-Frozen: ST6 Sialyltransferase 2/ST6GALNAC2 Antibody [NBP2-13392] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30
Immunohistochemistry-Paraffin: ST6 Sialyltransferase 2/ST6GALNAC2 Antibody [NBP2-13392] - Staining of human spleen shows strong cytoplasmic and nuclear positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST6 Sialyltransferase 2/ST6GALNAC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLL WGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPR DTPPKCIRCAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GALNAC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ST6 Sialyltransferase 2/ST6GALNAC2 Protein (NBP2-13392PEP)
Publications
Read Publication using
NBP2-13392 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody

  • (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B
  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2
  • EC 2.4.99.-
  • FLJ45660
  • GalNAc alpha-2,6-sialyltransferase II
  • SAITL1
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) B
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase)
  • Sialyltransferase 7B
  • sialyltransferase-like 1
  • SIAT7
  • SIAT7B
  • SIAT7-B
  • SIATL1
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 2
  • ST6GalNAc II
  • ST6GALNAC2
  • ST6GalNAcII
  • ST6GalNAII
  • STHM
  • STHM(alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00056913-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP2-13392
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392) (0)

There are no reviews for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST6 Sialyltransferase 2/ST6GALNAC2 Products

Bioinformatics Tool for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392)

Discover related pathways, diseases and genes to ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392)

Discover more about diseases related to ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392).
 

Pathways for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392)

View related products by pathway.

PTMs for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392)

Learn more about PTMs related to ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP2-13392).

Blogs on ST6 Sialyltransferase 2/ST6GALNAC2

There are no specific blogs for ST6 Sialyltransferase 2/ST6GALNAC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6 Sialyltransferase 2/ST6GALNAC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GALNAC2
Entrez