![Immunohistochemistry-Paraffin: ST3GAL2 Antibody [NBP1-87044] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/ST3GAL2-Antibody-Immunohistochemistry-Paraffin-NBP1-87044-img0001.jpg "Immunohistochemistry-Paraffin: ST3GAL2 Antibody [NBP1-87044] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ST3GAL2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunohistochemistry_6938.jpg)
![Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunocytochemistry_9821.jpg)
![Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/bba16_human-e-selectin-cd62e-mab-clone-bbig-e4-flow-cytometry-25102021144214.jpg)
| Publication using NBP1-87044 | Applications | Species |
|---|---|---|
| Yoon JY, Gedye C, Paterson J, Ailles L Stem/progenitor cell marker expression in clear cell renal cell carcinoma: a potential relationship with the immune microenvironment to be explored BMC Cancer 2020-04-03 [PMID: 32245446] (MiAr, Human) | MiAr | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ST3GAL2 |
![Western Blot ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody [Unconjugated]](https://images.novusbio.com/images2/ST3GAL1_AF6905_Western_Blot_14020.jpg)
![Simple Western ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST6GAL1_AF5924_Simple_Western_16761.jpg)
![Western Blot ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST6GAL1_AF5924_Western_Blot_9445.jpg)
![Immunocytochemistry ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5924_human-st6gal1-affinity-purified-polyclonal-ab-immunocytochemistry-31102022135751.jpg)
![Flow Cytometry BMPR-II Antibody [Unconjugated]](https://images.novusbio.com/images2/BMPRII_AF811_Flow_Cytometry_15364.jpg)
![Immunohistochemistry BMPR-II Antibody [Unconjugated]](https://images.novusbio.com/images2/BMPR-II_AF811_Immunohistochemistry_7345.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")