SSX1 Antibody

Images

 
Western Blot: SSX1 Antibody [H00006756-B02P] - Analysis of SSX1 expression in transfected 293T cell line by SSX1 polyclonal antibody. Lane 1: SSX1 transfected lysate(20.68 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SSX1 Antibody Summary

Immunogen
SSX1 (NP_005626.1, 1 a.a. - 188 a.a.) full-length human protein. MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SSX1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SSX1 Antibody

  • Cancer/testis antigen 5.1
  • CT5.1cancer/testis antigen family 5, member 1
  • MGC150425
  • protein SSX1
  • sarcoma, synovial, X-chromosome-related 1
  • SSRC
  • synovial sarcoma, X breakpoint 1MGC5162

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006757-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-95239
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91499
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-57508
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-86833
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85397
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00004102-M01
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP2-74372
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, WB
H00010214-P01
Species: Hu
Applications: ELISA, AP, IHC, IHC-P, PA, PAGE, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
1129-ER
Species: Hu
Applications: BA
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
AF5738
Species: Hu
Applications: ICC, KO, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00006756-B02P
Species: Hu
Applications: WB

Publications for SSX1 Antibody (H00006756-B02P) (0)

There are no publications for SSX1 Antibody (H00006756-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSX1 Antibody (H00006756-B02P) (0)

There are no reviews for SSX1 Antibody (H00006756-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSX1 Antibody (H00006756-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SSX1 Products

Bioinformatics Tool for SSX1 Antibody (H00006756-B02P)

Discover related pathways, diseases and genes to SSX1 Antibody (H00006756-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSX1 Antibody (H00006756-B02P)

Discover more about diseases related to SSX1 Antibody (H00006756-B02P).
 

Pathways for SSX1 Antibody (H00006756-B02P)

View related products by pathway.

PTMs for SSX1 Antibody (H00006756-B02P)

Learn more about PTMs related to SSX1 Antibody (H00006756-B02P).
 

Research Areas for SSX1 Antibody (H00006756-B02P)

Find related products by research area.

Blogs on SSX1

There are no specific blogs for SSX1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSX1
Uniprot