SSRP1 Recombinant Protein Antigen

Images

 
There are currently no images for SSRP1 Protein (NBP1-84754PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SSRP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SSRP1.

Source: E. coli

Amino Acid Sequence: DDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SSRP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84754.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SSRP1 Recombinant Protein Antigen

  • Chromatin-specific transcription elongation factor 80 kDa subunit
  • cisplatin-DNA SSRP
  • facilitates chromatin remodeling 80 kDa subunit
  • Facilitates chromatin transcription complex 80 kDa subunit
  • Facilitates chromatin transcription complex subunit SSRP1
  • FACT complex subunit SSRP1
  • FACT
  • FACT80FACT 80 kDa subunit
  • FACTp80
  • high mobility group box
  • hSSRP1
  • Recombination signal sequence recognition protein 1
  • structure specific recognition protein 1
  • Structure-specific recognition protein 1
  • T160

Background

SSRP1 is a nuclear protein and a component of the FACT complex (facilitates chromatin transcription). The FACT complex is composed of the SUPT16H (FACT140) and the SSRP1 FACTp80 proteins. This complex interacts with nucleosomes and histone H2A/H2B dimers to promote nucleosome disassembly and allow transcription elongation. This protein interacts with dsDNA. The SSRP1 protein has been shown to be modified by cisplatin and may protect DNA from repair and block DNA replication. The 10D7 monoclonal antibody recognizes the human SSRP1 protein and has been shown to be useful for Western blotting.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2322
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-38607
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-94448
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
DRG00
Species: Hu
Applications: ELISA
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP3-41295
Species: Hu
Applications: IHC,  IHC-P, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-16774
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86960
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-71648
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-13389
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for SSRP1 Protein (NBP1-84754PEP) (0)

There are no publications for SSRP1 Protein (NBP1-84754PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSRP1 Protein (NBP1-84754PEP) (0)

There are no reviews for SSRP1 Protein (NBP1-84754PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SSRP1 Protein (NBP1-84754PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SSRP1 Products

Blogs on SSRP1

There are no specific blogs for SSRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SSRP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SSRP1