Recombinant Human SSRP1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related SSRP1 Peptides and Proteins

Order Details


    • Catalog Number
      H00006749-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SSRP1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human SSRP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SSRP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SSRP1 GST (N-Term) Protein

  • Chromatin-specific transcription elongation factor 80 kDa subunit
  • cisplatin-DNA SSRP
  • facilitates chromatin remodeling 80 kDa subunit
  • Facilitates chromatin transcription complex 80 kDa subunit
  • Facilitates chromatin transcription complex subunit SSRP1
  • FACT complex subunit SSRP1
  • FACT
  • FACT80FACT 80 kDa subunit
  • FACTp80
  • high mobility group box
  • hSSRP1
  • Recombination signal sequence recognition protein 1
  • structure specific recognition protein 1
  • Structure-specific recognition protein 1
  • T160

Background

The protein encoded by this gene is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2322
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-38607
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-94448
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
DRG00
Species: Hu
Applications: ELISA
AF4654
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP3-41295
Species: Hu
Applications: IHC,  IHC-P, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-16774
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86960
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-71648
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-13389
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for SSRP1 Partial Recombinant Protein (H00006749-Q01) (0)

There are no publications for SSRP1 Partial Recombinant Protein (H00006749-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSRP1 Partial Recombinant Protein (H00006749-Q01) (0)

There are no reviews for SSRP1 Partial Recombinant Protein (H00006749-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSRP1 Partial Recombinant Protein (H00006749-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SSRP1 Products

Blogs on SSRP1

There are no specific blogs for SSRP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SSRP1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SSRP1