SRP19 Antibody


Western Blot: SRP19 Antibody [NBP1-89507] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SRP19 Antibody [NBP1-89507] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Western Blot: SRP19 Antibody [NBP1-89507] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-554

Product Details

Reactivity Hu, Mu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SRP19 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNR
Specificity of human, mouse SRP19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
SRP19 Protein (NBP1-89507PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SRP19 Antibody

  • signal recognition particle 19 kDa protein
  • signal recognition particle 19kD
  • signal recognition particle 19kDa


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SRP19 Antibody (NBP1-89507) (0)

There are no publications for SRP19 Antibody (NBP1-89507).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRP19 Antibody (NBP1-89507) (0)

There are no reviews for SRP19 Antibody (NBP1-89507). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRP19 Antibody (NBP1-89507) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SRP19 Products

Bioinformatics Tool for SRP19 Antibody (NBP1-89507)

Discover related pathways, diseases and genes to SRP19 Antibody (NBP1-89507). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRP19 Antibody (NBP1-89507)

Discover more about diseases related to SRP19 Antibody (NBP1-89507).

Pathways for SRP19 Antibody (NBP1-89507)

View related products by pathway.

PTMs for SRP19 Antibody (NBP1-89507)

Learn more about PTMs related to SRP19 Antibody (NBP1-89507).

Blogs on SRP19

There are no specific blogs for SRP19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SRP19 Antibody and receive a gift card or discount.


Gene Symbol SRP19