SRP19 Antibody

Images

 
Western Blot: SRP19 Antibody [NBP1-57415] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:12500 Positive Control: Human Small Intestine
Immunohistochemistry: SRP19 Antibody [NBP1-57415] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: N/A Other Working ...read more
Immunohistochemistry: SRP19 Antibody [NBP1-57415] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRP19 Antibody Summary

Immunogen
Synthetic peptides corresponding to SRP19(signal recognition particle 19kDa) The peptide sequence was selected from the middle region of SRP19. Peptide sequence CLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRP19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against SRP19 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SRP19 Antibody

  • signal recognition particle 19 kDa protein
  • signal recognition particle 19kD
  • signal recognition particle 19kDa

Background

SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-13380
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89532
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89498
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61107
Species: Hu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-45945
Species: Hu
Applications: WB, Flow, IHC
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24751
Species: Hu, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
AF4885
Species: Mu
Applications: WB, IP
NBP1-57372
Species: Hu
Applications: WB
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16215
Species: Hu
Applications: WB, ChIP, IP
NBP1-57415
Species: Hu
Applications: WB, IHC

Publications for SRP19 Antibody (NBP1-57415) (0)

There are no publications for SRP19 Antibody (NBP1-57415).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRP19 Antibody (NBP1-57415) (0)

There are no reviews for SRP19 Antibody (NBP1-57415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRP19 Antibody (NBP1-57415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRP19 Products

Bioinformatics Tool for SRP19 Antibody (NBP1-57415)

Discover related pathways, diseases and genes to SRP19 Antibody (NBP1-57415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRP19 Antibody (NBP1-57415)

Discover more about diseases related to SRP19 Antibody (NBP1-57415).
 

Pathways for SRP19 Antibody (NBP1-57415)

View related products by pathway.

PTMs for SRP19 Antibody (NBP1-57415)

Learn more about PTMs related to SRP19 Antibody (NBP1-57415).

Blogs on SRP19

There are no specific blogs for SRP19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRP19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRP19