Home » SR140 » SR140 Antibodies » SR140 Antibody

SR140 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SR140 Antibody [NBP1-70713] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: SR140 Antibody [NBP1-70713] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SR140 Antibody Summary

Immunogen
Synthetic peptides corresponding to SR140(U2-associated SR140 protein) The peptide sequence was selected from the N terminal of SR140. Peptide sequence NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
U2SURP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SR140 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SR140 Antibody

  • 140 kDa Ser/Arg-rich domain protein
  • FSAPa
  • KIAA0332
  • SR140
  • U2 snRNP-associated SURP domain containing
  • U2 snRNP-associated SURP motif-containing protein
  • U2-associated protein SR140
  • U2-Associated SR140 Protein
  • U2SURP

Background

The specific function of SR140 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Substance P
Antibody (266815)
MAB4375
Substance P was detected in immersion fixed paraffin-embedded sections of human spinal cord using 8 µg/mL Human/Mouse/Rat Substance P Monoclonal Antibody (Catalog # MAB4375) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the spinal cord dorsal horn. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC

NK3R/TACR3/Neurokinin ...
NB300-102
NK3R/TACR3/Neurokinin B Receptor Antibody
(27 Publications)
Species: Mu, Rt, GP, Sh, Hu(-)
Applications: WB (-), ICC/IF, IHC, IHC-Fr, IHC-FrFl
Neurokinin B
Antibody
NB300-201
Immunohistochemistry: Neurokinin B Antibody [NB300-201] - Detection of Neurokinin B in rat brain tissue (Alexa 488 stain), using NB 300-201.
Immunohistochemistry-Paraffin: Neurokinin B Antibody [NB300-201] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse brain using Neurokinin B antibody at 1:200 dilution. The antibody depicted an expected strong cytoplasmic staining in the neuronal cells.
Immunohistochemistry-Paraffin: Neurokinin B Antibody [NB300-201] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse brain using Neurokinin B antibody at 1:100 dilution. The antibody showed a specific cytoplasmic staining in the Purkinje cells and some granular neurons from the granular layer with weak signal in the fibers within the molecular layer of the section.
(2 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(10 Publications)
Species: Hu
NK1R Antibody
NB300-119
Western Blot: NK1R Antibody [NB300-119] - Total protein from human, mouse and rat brain was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NK1R in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Neurokinin 1 Receptor Antibody [NB300-119] - Immunostain of NK1R in rat enteric glial cells. Image courtesy of anonymous customer review.
Immunohistochemistry: NK1R Antibody [NB300-119] - Neurokinin 1 Receptor Antibody [NB300-119] - Staining of human brain, basal nucleus of Meynert, neurons.
(2 Reviews)
(30 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
RNPS1 Antibody
NBP1-92343
Western Blot: RNPS1 Antibody [NBP1-92343] - Analysis in human cell line RT-4
Immunocytochemistry/Immunofluorescence: RNPS1 Antibody [NBP1-92343] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RNPS1 Antibody [NBP1-92343] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Ovalbumin Antibody
NB600-922
Western Blot: Ovalbumin Antibody [NB600-922] - Lane 1: Reduced Ovalbumin. Load: 50 ng. Primary antibody: Ovalbumin antibody at 1:1,000 overnight at 4C. Secondary antibody: Peroxidase rabbit secondary antibody at 1:40,000 for 30 min at RT. Block: Blocking Buffer for Fluorescent Western Blotting for 30 min at RT. Predicted/Observed size: 45 kDa, 45 kDa for Ovalbumin.
Western Blot: Ovalbumin Antibody [NB600-922] - Western blot detection of Ovalbumin from hen egg white using NB600-922 at 1:10,000. The blot was blocked ON at 4 degrees C in 3% BSA. The secondary antibody used was a DyLight 649 Conjugated Goat anti-rabbit IgG (H&L) diluted 1:20,000 and incubated 1 hr RT in blocking buffer for fluorescent western blotting.
Western Blot: Ovalbumin Antibody [NB600-922] - Analysis using the HRP conjugate of NB600-922. Detection of Lane 1: Ovalbumin (Hen Egg). Load: 50 ng per lane. Dilution: 1:1,000. Predicted/Observed size: 43 kDa, 43 kDa for Ovalbumin. Other band(s): Ovalbumin splice variants and isoforms.
(4 Publications)
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
CD161/NK1.1
Antibody (PK136)
NB100-77528
Flow Cytometry: CD161/NK1.1 Antibody (PK136) [NB100-77528] - Analysis using the PE/Cy7 conjugate of NB100-77528. Staining of C57BL/6 splenocytes with Anti-Mouse CD49b (Integrin alpha 2) FITC and staining buffer (autofluorescence) (left) or Anti-Mouse NK1.1 PE-Cy7 (right). Total viable cells were used for analysis.
Flow Cytometry: CD161/NK1.1 Antibody (PK136) [NB100-77528] - Mouse splenocytes were stained with CD49b (DX5) APC and purified NK1.1 (clone PK136) (top) or mouse IgG2a isotype control (bottom), followed by anti-mouse IgG2a FITC.
Flow Cytometry: CD161/NK1.1 Antibody (PK136) [NB100-77528] - C57BL/6 mouse splenocytes stained with purified PK136, followed by anti-mouse IgG2a FITC
(2 Publications)
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
TIMM8A Antibody
NBP1-84288
Immunocytochemistry/Immunofluorescence: TIMM8A Antibody [NBP1-84288] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: TIMM8A Antibody [NBP1-84288] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
gamma-Synuclein
Antibody (JM90-32)
NBP2-66861
Immunocytochemistry/Immunofluorescence: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Staining gamma Synuclein in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of paraffin-embedded rat bladder tissue using anti-gamma Synuclein antibody. Counter stained with hematoxylin.
Flow Cytometry: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of Hela cells with gamma Synuclein antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Secretin R Antibody
AF6387
Western blot shows lysates of human brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Human Secretin R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6387) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Secretin R delta 3/4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
TFF2 was detected in immersion fixed paraffin-embedded sections of human stomach using Mouse Anti-Human TFF2 Monoclonal Antibody (Catalog # MAB4077) at 1.7 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to gastric glands. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Publication)
Species: Hu
Applications: WB, IHC

Publications for SR140 Antibody (NBP1-70713) (0)

There are no publications for SR140 Antibody (NBP1-70713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SR140 Antibody (NBP1-70713) (0)

There are no reviews for SR140 Antibody (NBP1-70713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SR140 Antibody (NBP1-70713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SR140 Products

SR140 NBP1-70713

Bioinformatics Tool for SR140 Antibody (NBP1-70713)

Discover related pathways, diseases and genes to SR140 Antibody (NBP1-70713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SR140

There are no specific blogs for SR140, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SR140 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol U2SURP
Entrez