New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » SR140 » SR140 Antibodies » SR140 Antibody

SR140 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SR140 Antibody [NBP1-70713] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: SR140 Antibody [NBP1-70713] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SR140 Antibody Summary

Immunogen
Synthetic peptides corresponding to SR140(U2-associated SR140 protein) The peptide sequence was selected from the N terminal of SR140. Peptide sequence NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
U2SURP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SR140 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SR140 Antibody

  • 140 kDa Ser/Arg-rich domain protein
  • FSAPa
  • KIAA0332
  • SR140
  • U2 snRNP-associated SURP domain containing
  • U2 snRNP-associated SURP motif-containing protein
  • U2-associated protein SR140
  • U2-Associated SR140 Protein
  • U2SURP

Background

The specific function of SR140 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Substance P
Antibody (266815)
MAB4375
Substance P was detected in immersion fixed paraffin-embedded sections of human spinal cord using 8 µg/mL Human/Mouse/Rat Substance P Monoclonal Antibody (Catalog # MAB4375) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the spinal cord dorsal horn. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: IHC

NK3R/TACR3/Neurokinin ...
NB300-102
NK3R/TACR3/Neurokinin B Receptor Antibody
(34 Publications)
Species: Gp, Hu(-), Mu, Rt, Sh
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, WB (-)
Neurokinin B
Antibody - BSA Free
NB300-201
Immunohistochemistry: Neurokinin B Antibody [NB300-201] - IF analysis of Neurokinin B in mouse hypothalamus. Image courtesy of an anonymous customer review.
Immunohistochemistry: Neurokinin B Antibody [NB300-201] - Detection of Neurokinin B in rat brain tissue (Alexa 488 stain), using NB 300-201.
Immunohistochemistry-Paraffin: Neurokinin B Antibody [NB300-201] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse brain using Neurokinin B antibody at 1:200 dilution. The antibody depicted an expected strong cytoplasmic staining in the neuronal cells.
(2 Reviews)
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(17 Publications)
Species: Hu
Applications: BA
NK1R Antibody -
BSA Free
NB300-119
Western Blot: NK1R Antibody [NB300-119] - TACR1 and its downstream targets SRC and p-SRC are expressed in neuroblastoma cell lines. Endogenous TACR1 (NK1R), SRC and p-SRC expression in whole-cell extracts of neuroblastoma cell lines was visualized by western blotting. GAPDH was used as a loading control. Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.13440), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: NK1R Antibody [NB300-119] - Neurokinin 1 Receptor Antibody [NB300-119] - Immunostain of NK1R in rat enteric glial cells. Image from verified customer review.
Immunohistochemistry: NK1R Antibody [NB300-119] - Neurokinin 1 Receptor Antibody [NB300-119] - Staining of human brain, basal nucleus of Meynert, neurons.
(2 Reviews)
(37 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
RNPS1 Antibody
(7G8)
H00010921-M05
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in HeLa.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in PC-12.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in 293.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Ovalbumin Antibody
NB600-922
Western Blot: Ovalbumin Antibody [NB600-922] - Analysis using the HRP conjugate of NB600-922. Detection of Lane 1: Ovalbumin (Hen Egg). Load: 50 ng per lane. Dilution: 1:1,000. Predicted/Observed size: 43 kDa, 43 kDa for Ovalbumin. Other band(s): Ovalbumin splice variants and isoforms.
Western Blot: Ovalbumin Antibody [NB600-922] - Analysis using the HRP conjugate of NB600-922. Detection of Lane 1: Ovalbumin. Load: 50 ng per lane. Dilution: 1:1,000. Predicted/Observed size: 43 kDa, 43 kDa for Ovalbumin. Other band(s): Ovalbumin splice variants and isoforms.
Western Blot: Ovalbumin Antibody [NB600-922] - Analysis using the HRP conjugate of NB600-922. Detection of purified egg white proteins (lysozyme, ovalbumin, ovotransferrin). Image from verified customer review.
(8 Publications)
Species: Ch
Applications: ELISA, IHC, IHC-P, IP, Single-Cell Western, WB
CD161 Antibody
(14F1F11) - BSA Free
NBP2-14845
Immunohistochemistry-Paraffin: CD161 Antibody (14F1F11) [NBP2-14845] - Analysis using Azide Free version of NBP2-14845. CD161 in human kidney using CD161 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: CD161 Antibody (14F1F11) - BSA Free [NBP2-14845] - Analysis of a FFPE tissue section of human spleen using 1:200 dilution of CD161 [14F1F11] antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
Western Blot: CD161 Antibody (14F1F11) [NBP2-14845] - Analysis of a partial CD161 recombinant protein using CD161 antibody at 1 ug/ml.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
TIMM8A Antibody
(2F11)
H00001678-M01
Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11.Lane 1: TIMM8A transfected lysate(11 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
Sandwich ELISA: TIMM8A Antibody (2F11) [H00001678-M01] - Detection limit for recombinant GST tagged TIMM8A is approximately 0.3ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
gamma-Synuclein
Antibody (JM90-32)
NBP2-66861
Flow Cytometry: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of Hela cells with gamma Synuclein antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunocytochemistry/Immunofluorescence: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Staining gamma Synuclein in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of paraffin-embedded human breast cancer tissue using anti-gamma Synuclein antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Secretin R Antibody
AF6387
Western blot shows lysates of human brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Human Secretin R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6387) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Secretin R delta 3/4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
TFF2 was detected in immersion fixed paraffin-embedded sections of human stomach using Mouse Anti-Human TFF2 Monoclonal Antibody (Catalog # MAB4077) at 1.7 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to gastric glands. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, WB

Publications for SR140 Antibody (NBP1-70713) (0)

There are no publications for SR140 Antibody (NBP1-70713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SR140 Antibody (NBP1-70713) (0)

There are no reviews for SR140 Antibody (NBP1-70713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SR140 Antibody (NBP1-70713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SR140 Products

Array NBP1-70713

Bioinformatics Tool for SR140 Antibody (NBP1-70713)

Discover related pathways, diseases and genes to SR140 Antibody (NBP1-70713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SR140

There are no specific blogs for SR140, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SR140 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol U2SURP