SPTSSB Recombinant Protein Antigen

Product Discontinued

SPTSSB Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPTSSB.

  Source: E. coli

  Amino Acid Sequence: WAHTSSPGTILSSISLGESTFLTINLLATAGKVAGCEWGGEGRFTRSEAPKLAASAKRLCFLRFLTNKWGGM

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SPTSSB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55749.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SPTSSB Recombinant Protein Antigen

• ADMPsmall subunit of serine palmitoyltransferase B
• chromosome 3 open reading frame 57
• likely ortholog of androgen down regulated gene expressed in mouse prostate
• MGC104229
• Protein ADMP
• SSSPTB

Background

Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serinepalmitoyltransferase (SPT) complex determines the substrate preference, complexes with this subunit showing a clearpreference for longer acyl-CoAs. The SPTLC1-SPTLC2-SSSPTB complex shows a strong preference for C18-CoA substrate,while the SPTLC1-SPTLC3-SSSPTB isozyme displays an ability to use a broader range of acyl-CoAs, without apparentpreference. May play a role in signal transduction

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SPTSSB