SPTSSB Antibody

Immunocytochemistry/Immunofluorescence: SPTSSB Antibody [NBP2-55749] - Staining of human cell line MCF7 shows localization to nuclear speckles.

Product Discontinued

SPTSSB Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WAHTSSPGTILSSISLGESTFLTINLLATAGKVAGCEWGGEGRFTRSEAPKLAASAKRLCFLRFLTNKWGGM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPTSSB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SPTSSB Antibody

• ADMPsmall subunit of serine palmitoyltransferase B
• chromosome 3 open reading frame 57
• likely ortholog of androgen down regulated gene expressed in mouse prostate
• MGC104229
• Protein ADMP
• ssSPTb

Background

Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serinepalmitoyltransferase (SPT) complex determines the substrate preference, complexes with this subunit showing a clearpreference for longer acyl-CoAs. The SPTLC1-SPTLC2-SSSPTB complex shows a strong preference for C18-CoA substrate,while the SPTLC1-SPTLC3-SSSPTB isozyme displays an ability to use a broader range of acyl-CoAs, without apparentpreference. May play a role in signal transduction

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPTSSB