SPTLC3 Antibody


Western Blot: SPTLC3 Antibody [NBP2-54899] - Analysis in human cell line U-87 MG.
Immunocytochemistry/ Immunofluorescence: SPTLC3 Antibody [NBP2-54899] - Staining of human cell line Hep G2 shows localization to microtubules. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF
0.1 mg/ml

Order Details

SPTLC3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA
Specificity of human SPTLC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
0.1 mg/ml
Immunogen affinity purified

Alternate Names for SPTLC3 Antibody

  • C20orf38
  • Chromosome 20 Open Reading Frame 38
  • dJ718P11
  • EC
  • hLCB2b
  • LCB 3
  • LCB2B
  • LCB3
  • Long Chain Base Biosynthesis Protein 2b
  • Long Chain Base Biosynthesis Protein 3
  • Serine Palmitoyltransferase 3
  • Serine Palmitoyltransferase, Long Chain Base Subunit 2-Like (Aminotransferase 2)
  • Serine Palmitoyltransferase, Long Chain Base Subunit 3
  • Serine-Palmitoyl-CoA Transferase 3
  • SPT 3
  • SPT3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ChIP, ChIP, CHIP-SEQ, KD
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, PEP-ELISA
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF

Publications for SPTLC3 Antibody (NBP2-54899) (0)

There are no publications for SPTLC3 Antibody (NBP2-54899).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPTLC3 Antibody (NBP2-54899) (0)

There are no reviews for SPTLC3 Antibody (NBP2-54899). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPTLC3 Antibody (NBP2-54899) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SPTLC3 Products

Bioinformatics Tool for SPTLC3 Antibody (NBP2-54899)

Discover related pathways, diseases and genes to SPTLC3 Antibody (NBP2-54899). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPTLC3 Antibody (NBP2-54899)

Discover more about diseases related to SPTLC3 Antibody (NBP2-54899).

Blogs on SPTLC3

There are no specific blogs for SPTLC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPTLC3 Antibody and receive a gift card or discount.


Gene Symbol SPTLC3