Recombinant Human SPRED2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPRED2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 120 - 219 of Human SPRED2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPCRQVSFPDDDEEIVRINP

Protein/Peptide Type
Partial Recombinant Protein
Gene
SPRED2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPRED2 Protein

  • FLJ31917
  • MGC163164
  • SPRED2
  • Spred-2related sequence
  • sprouty-related, EVH1 domain containing 2
  • sprouty-related, EVH1 domain-containing protein 2

Background

SPRED2 - sprouty-related, EVH1 domain containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5067
Species: Hu
Applications: WB
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00010253-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF4538
Species: Hu, Mu, Rt
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
H00200734-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SPRED2 Partial Recombinant Protein (H00200734-Q01) (0)

There are no publications for SPRED2 Partial Recombinant Protein (H00200734-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRED2 Partial Recombinant Protein (H00200734-Q01) (0)

There are no reviews for SPRED2 Partial Recombinant Protein (H00200734-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPRED2 Partial Recombinant Protein (H00200734-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPRED2 Products

Bioinformatics Tool for SPRED2 Partial Recombinant Protein (H00200734-Q01)

Discover related pathways, diseases and genes to SPRED2 Partial Recombinant Protein (H00200734-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPRED2 Partial Recombinant Protein (H00200734-Q01)

Discover more about diseases related to SPRED2 Partial Recombinant Protein (H00200734-Q01).
 

Pathways for SPRED2 Partial Recombinant Protein (H00200734-Q01)

View related products by pathway.

PTMs for SPRED2 Partial Recombinant Protein (H00200734-Q01)

Learn more about PTMs related to SPRED2 Partial Recombinant Protein (H00200734-Q01).
 

Research Areas for SPRED2 Partial Recombinant Protein (H00200734-Q01)

Find related products by research area.

Blogs on SPRED2

There are no specific blogs for SPRED2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPRED2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPRED2
Entrez