SPR Antibody

Images

 
Western Blot: SPR Antibody [H00006697-B01P] - Analysis of SPR expression in transfected 293T cell line by SPR polyclonal antibody. Lane1:SPR transfected lysate(28.71 KDa). Lane2:Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPR Antibody Summary

Immunogen
SPR (AAH17310.1, 1 a.a. - 261 a.a.) full-length human protein. MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SPR
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.
Publications
Read Publication using H00006697-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPR Antibody

  • EC 1.1.1.153
  • SDR38C1
  • sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
  • sepiapterin reductase
  • short chain dehydrogenase/reductase family 38C, member 1

Background

This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF8038
Species: Hu, Mu, Rt
Applications: WB
AF6387
Species: Hu
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
H00006697-B01P
Species: Hu
Applications: WB

Publications for SPR Antibody (H00006697-B01P)(1)

Reviews for SPR Antibody (H00006697-B01P) (0)

There are no reviews for SPR Antibody (H00006697-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPR Antibody (H00006697-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPR Products

Bioinformatics Tool for SPR Antibody (H00006697-B01P)

Discover related pathways, diseases and genes to SPR Antibody (H00006697-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPR Antibody (H00006697-B01P)

Discover more about diseases related to SPR Antibody (H00006697-B01P).
 

Pathways for SPR Antibody (H00006697-B01P)

View related products by pathway.

PTMs for SPR Antibody (H00006697-B01P)

Learn more about PTMs related to SPR Antibody (H00006697-B01P).

Blogs on SPR

There are no specific blogs for SPR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPR
Uniprot