SPOPL Antibody

Immunocytochemistry/Immunofluorescence: SPOPL Antibody [NBP1-86315] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.

Immunohistochemistry-Paraffin: SPOPL Antibody [NBP1-86315] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SPOPL Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVA
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPOPL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SPOPL Protein (NBP1-86315PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPOPL Antibody

• FLJ53775
• HIB homolog 2
• Roadkill homolog 2
• speckle-type POZ protein-like

Background

In complex with a cullin, may act in ubiquitination and proteasomal degradation processes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPOPL